PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010534200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family Nin-like
Protein Properties Length: 819aa    MW: 92077 Da    PI: 6.0277
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010534200.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.6e-29522572252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+++l++l++yF++++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  XP_010534200.1 522 EKTVTLDVLRQYFAGSLKDAAKSLGVCPTTLKRICRQHGIQRWPSRKIKKV 572
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.575511592IPR003035RWP-RK domain
PfamPF020422.3E-26524572IPR003035RWP-RK domain
SuperFamilySSF542779.57E-23715808No hitNo description
SMARTSM006669.0E-23724807IPR000270PB1 domain
PROSITE profilePS5174526.338724807IPR000270PB1 domain
CDDcd064073.53E-40725805No hitNo description
Gene3DG3DSA:3.10.20.2408.9E-20725804No hitNo description
PfamPF005646.1E-18726805IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MGDNVLQPVM DIEFMDELLF DGCWLETMEE SEFLDFSPST SINPFDPSPL TRSPPQDTQT  60
ISSSDISQMF CQDIAERSGL DEAEGNRRWW IGPTRGSPGG PGCSVMERLV QALKYIKDFT  120
RERGSLIQLW VPVNRGGKRV LTTKEQPFAI DPICRKLASY REISESFHFS AEMEDSKEIP  180
EWSPDVRFFR SEEYPRVHHA QDCDVRGTLA IPVFEQCSKI CLGVIEIVMT TQMVKSRPEL  240
ETISRALQAV DLRSTEVPVP SPAKARDISY RAALPEIRNL LRCACETHKL PLAQTWVSCL  300
RQDKPGCRHN IDNYVHCVST VDDACFVFDP TVQEFHEACS EHHLLKGQGV SGQAFLTNQP  360
CFSPDVTVFK KTEYPLSHHA TVFGLRAAVS IRLRSILTGS ADFVLEFFLP KGCRDLEEQR  420
TMLNSLSTIV ANMSRSLRTV SDKELEEEAE SMRGEVIERE EMVPKVEDNL HESSSWNTES  480
RQIKSDLRKL GQVSNGGGAS EIGEQNGGGF SIMAEKKRAK TEKTVTLDVL RQYFAGSLKD  540
AAKSLGVCPT TLKRICRQHG IQRWPSRKIK KVGRSLQKIQ RVIASVEGVS GPLPVSSFYP  600
NFPNTLQPAK NCPAPFLLQH GSHVKSPSSS CTQSSSSSQC YSSETQLNNL PVSRKSCSAE  660
DTVNGENSLV NDCATKRTRS EAEVHSLSRE ETTTFFSRLQ SHDSLKENPS LENTHLPSSQ  720
DEDFLRMKVT YGDEKIRFRM RNSCRLKDLS REIAKRYNID DMSRYDLKYL DDDNEWVLLT  780
CDDDVEECID VCGSSPGHTI KLLLQVCSFH LPERSSVSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010534200.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLR0GUM30.0R0GUM3_9BRAS; Uncharacterized protein
STRINGAT1G20640.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein